PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00018.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 1145aa    MW: 128779 Da    PI: 8.504
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00018.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.49.3e-29958150
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   krien++nrqvt+skRrngi+KKA+EL vLCda+v++i+fsstgk++e+ 
  Jcr4S00018.10  9 KRIENSTNRQVTYSKRRNGIFKKAQELTVLCDAKVSLIMFSSTGKFHEFF 58
                   79**********************************************96 PP

2K-box61.72.8e-2171139169
          K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                    yqk+ g +l+++++e++q++l+kL++ + +L+re+R++lGedL++Ls+ e+++Le++++++lk +R+kK
  Jcr4S00018.10  71 YQKNLGIDLWSTHYERMQENLRKLREINTKLRREIRQRLGEDLNDLSIDEMRSLEERMDSALKLVRDKK 139
                    78999999************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.786161IPR002100Transcription factor, MADS-box
CDDcd002651.45E-39280No hitNo description
SuperFamilySSF554552.62E-36294IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-263859IPR002100Transcription factor, MADS-box
PfamPF014868.6E-1382139IPR002487Transcription factor, K-box
PROSITE profilePS5129711.56984165IPR002487Transcription factor, K-box
PfamPF142236.4E-22237369No hitNo description
PfamPF077271.8E-86777996IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566723.42E-237821135No hitNo description
CDDcd092723.06E-5810281145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1145 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT YSKRRNGIFK KAQELTVLCD AKVSLIMFSS TGKFHEFFSP  60
TTSTKKIFDQ YQKNLGIDLW STHYERMQEN LRKLREINTK LRREIRQRLG EDLNDLSIDE  120
MRSLEERMDS ALKLVRDKKI YTSSLKQGLE ESVIMYLNYT XETSSTTPTV LEMPTLNPSE  180
TQLVSINASA QAPFKLTATN YQSWHTQWYS LLVGYDFLKF AENPITSNLT TSSYLFRQDQ  240
LLRSAMIASL SPDVVSYVVD EKTSHDLWVT LEKTYAKPSQ ARIMSLRESL FTTKKGISSV  300
TEFLQKIKSI TTTLAAAGVV ITMNETVLHV LHGLPTEYKE VSAAIRARDS EISFDDLHDK  360
LTDFESQLNR ESNLVVTPTT VNYTAKNKAG SSTAAPQSSA FVNSGNFSGT PTSSTYKNRV  420
KCQFCDRPGH VTKQCFKLKK LLPWLFNENS TAAGSKTQAQ VNCVTSNRQT NDPRWVVDSG  480
ANQHVVEDLK NLAIHSDYEG SDNVFLGDGK SYPISHTGTV TLNSATKPLS LKNVLCFPAL  540
DKNLIYVYKL CTDNNVGVTF NPFLFTVKDL STRELLAEGK PTNGIYEWPP NLSRATQSAY  600
KCYDPHSSKI YLSHHVDFIE SDFPFNSLAT ALERPESHTL DTWSPIHFIL PMSTGLDSSG  660
QPNYVNTDSS ASPSLVQQQP EHSNISDSGS GTEISNSPIL LPTQSDVVSS LPLASNLNQN  720
VHLMVTRRKN QIQKLINRLC LSIEVQSDIQ FVPKTVAQAM KDPKWRSAME EEYQALKEAE  780
NLEFVRYKAR LVARGFTQRP GLDFDQTFSP VAKHPTVRVI LSIAVSKNWP LRQVDVNNAF  840
LHGKLNEDVF MEQPPGFIQH HNLKFVCKLE KSLYGLKQAP RVWYSALTSF LIAAGFQQSK  900
SDSCLFIYHR QGTILYLLVY VDDIIITGSS AMRIEAFINQ LGKDFSIKDL GNLHYFLGVE  960
VKRTATGLFL SQHNYIRDLL EKAHMHEAKS ASTPMSSTMT LNSSDSACLQ DATVYRALIG  1020
KQTDDDLHAF SDADWAGNHD DRTSTSAYII FLGKNPVAWS SKKQKTIARS STEAEYKSVA  1080
STAADLAWVR NLLDELQFPR PKSSVIYCDN LGATYVAANP VFHSRMKHIA IDYHFVRQQV  1140
QNGTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7300741e-167KF730074.1 Jatropha sp. CONN 198700232 clone JatTM6_1 MADS-box transcription factor mRNA, partial cds.
GenBankKF7300751e-167KF730075.1 Jatropha sp. CONN 198700232 clone JAtTM6_2 MADS-box transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067590.10.0PREDICTED: uncharacterized protein LOC105630400
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-56MIKC_MADS family protein